General Information

  • ID:  hor000777
  • Uniprot ID:  P05060
  • Protein name:  GAWK peptide
  • Gene name:  CHGB
  • Organism:  Homo sapiens (Human)
  • Family:  Chromogranin/secretogranin protein family
  • Source:  Human
  • Expression:  Expressed in the adrenal medulla, and in pheochromocytoma. Not expressed in liver.
  • Disease:  Diseases associated with CHGB include Pheochromocytoma and Neuroendocrine Tumor.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005515 protein binding
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005788 endoplasmic reticulum lumen; GO:0030141 secretory granule

Sequence Information

  • Sequence:  FLGEGHHRVQENQMDKARRHPQGAWKELDRNYLNYGEEGAPGKWQQQGDLQDTKENREEARFQDKQYSSHHTAE
  • Length:  74(440-513)
  • Propeptide:  MQPTLLLSLLGAVGLAAVNSMPVDNRNHNEGMVTRCIIEVLSNALSKSSAPPITPECRQVLKTSRKDVKDKETTENENTKFEVRLLRDPADASEAHESSSRGEAGAPGEEDIQGPTKADTEKWAEGGGHSRERADEPQWSLYPSDSQVSEEVKTRHSEKSQREDEEEEEGENYQKGERGEDSSEEKHLEEPGETQNAFLNERKQASAIKKEELVARSETHAAGHSQEKTHSREKSSQESGEETGSQENHPQESKG
  • Signal peptide:  MQPTLLLSLLGAVGLAAVNS
  • Modification:  T35 Sulfotyrosine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Secretogranin-1 is a neuroendocrine secretory granule protein, which may be the precursor for other biologically active peptides.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9XVX1-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q9XVX1-F1.pdbhor000777_AF2.pdbhor000777_ESM.pdb

Physical Information

Mass: 1009570 Formula: C376H564N122O123S
Absent amino acids: CI Common amino acids: EQ
pI: 6.35 Basic residues: 16
Polar residues: 18 Hydrophobic residues: 14
Hydrophobicity: -183.51 Boman Index: -28192
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 31.76
Instability Index: 4369.59 Extinction Coefficient cystines: 15470
Absorbance 280nm: 211.92

Literature

  • PubMed ID:  3970711
  • Title:  GAWK, a Novel Human Pituitary Polypeptide: Isolation, Immunocytochemical Localization and Complete Amino Acid Sequence